Placeholder image of a protein
Icon representing a puzzle

2318: Electron Density Reconstruction 45

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
June 14, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has two copies in it. The puzzle will likely look a bit familiar to those who have played other Reconstruction puzzles. Different structures, but similar look to them.

Sequence
PMISEEREPLADVIEKGDEIKVVAEVPGVNKEDIKVKVTNGGKKLVITAKSEDRQYYKEIDLPAEVDEKAAKANFKNGVLEITLKKKASS

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 27,531
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 27,260
  1. Avatar for Idiotboy 31. Idiotboy Lv 1 6 pts. 28,602
  2. Avatar for Anfinsen_slept_here 32. Anfinsen_slept_here Lv 1 5 pts. 28,589
  3. Avatar for hansvandenhof 33. hansvandenhof Lv 1 5 pts. 28,474
  4. Avatar for RichGuilmain 34. RichGuilmain Lv 1 4 pts. 28,428
  5. Avatar for Trajan464 35. Trajan464 Lv 1 4 pts. 28,409
  6. Avatar for hada 36. hada Lv 1 3 pts. 28,401
  7. Avatar for Oransche 37. Oransche Lv 1 3 pts. 28,366
  8. Avatar for apetrides 38. apetrides Lv 1 2 pts. 28,362
  9. Avatar for AlphaFold2 39. AlphaFold2 Lv 1 2 pts. 28,355
  10. Avatar for rezaefar 40. rezaefar Lv 1 2 pts. 28,351

Comments