Placeholder image of a protein
Icon representing a puzzle

2318: Electron Density Reconstruction 45

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
June 14, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has two copies in it. The puzzle will likely look a bit familiar to those who have played other Reconstruction puzzles. Different structures, but similar look to them.

Sequence
PMISEEREPLADVIEKGDEIKVVAEVPGVNKEDIKVKVTNGGKKLVITAKSEDRQYYKEIDLPAEVDEKAAKANFKNGVLEITLKKKASS

Top groups


  1. Avatar for Go Science 100 pts. 29,115
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 29,084
  3. Avatar for Contenders 3. Contenders 37 pts. 29,004
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 29,003
  5. Avatar for Australia 5. Australia 11 pts. 28,880
  6. Avatar for Marvin's bunch 6. Marvin's bunch 5 pts. 28,874
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 28,808
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 28,689
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 28,355
  10. Avatar for VeFold 10. VeFold 1 pt. 28,355

  1. Avatar for Sandrix72
    1. Sandrix72 Lv 1
    100 pts. 29,115
  2. Avatar for LociOiling 2. LociOiling Lv 1 93 pts. 29,083
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 87 pts. 29,062
  4. Avatar for Galaxie 4. Galaxie Lv 1 80 pts. 29,051
  5. Avatar for Aubade01 5. Aubade01 Lv 1 74 pts. 29,034
  6. Avatar for gmn 6. gmn Lv 1 69 pts. 29,030
  7. Avatar for MicElephant 7. MicElephant Lv 1 64 pts. 29,004
  8. Avatar for christioanchauvin 8. christioanchauvin Lv 1 59 pts. 29,003
  9. Avatar for blazegeek 9. blazegeek Lv 1 54 pts. 29,000
  10. Avatar for Wanderer09 10. Wanderer09 Lv 1 50 pts. 28,986

Comments