Placeholder image of a protein
Icon representing a puzzle

2318: Electron Density Reconstruction 45

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
June 14, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has two copies in it. The puzzle will likely look a bit familiar to those who have played other Reconstruction puzzles. Different structures, but similar look to them.

Sequence
PMISEEREPLADVIEKGDEIKVVAEVPGVNKEDIKVKVTNGGKKLVITAKSEDRQYYKEIDLPAEVDEKAAKANFKNGVLEITLKKKASS

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 27,531
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 27,260
  1. Avatar for furi0us 61. furi0us Lv 1 1 pt. 27,219
  2. Avatar for maxb 62. maxb Lv 1 1 pt. 25,582
  3. Avatar for Rocky Roccoco 63. Rocky Roccoco Lv 1 1 pt. 20,477
  4. Avatar for bussei 64. bussei Lv 1 1 pt. 19,522
  5. Avatar for jacquero 65. jacquero Lv 1 1 pt. 18,057
  6. Avatar for ZeroLeak7 66. ZeroLeak7 Lv 1 1 pt. 17,867
  7. Avatar for mmmooonnneeeyyy 67. mmmooonnneeeyyy Lv 1 1 pt. 17,867
  8. Avatar for ivalnic 68. ivalnic Lv 1 1 pt. 17,867
  9. Avatar for NathanGrin 69. NathanGrin Lv 1 1 pt. 17,867

Comments