Placeholder image of a protein
Icon representing a puzzle

2318: Electron Density Reconstruction 45

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
June 14, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has two copies in it. The puzzle will likely look a bit familiar to those who have played other Reconstruction puzzles. Different structures, but similar look to them.

Sequence
PMISEEREPLADVIEKGDEIKVVAEVPGVNKEDIKVKVTNGGKKLVITAKSEDRQYYKEIDLPAEVDEKAAKANFKNGVLEITLKKKASS

Top groups


  1. Avatar for Go Science 100 pts. 29,115
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 29,084
  3. Avatar for Contenders 3. Contenders 37 pts. 29,004
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 29,003
  5. Avatar for Australia 5. Australia 11 pts. 28,880
  6. Avatar for Marvin's bunch 6. Marvin's bunch 5 pts. 28,874
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 28,808
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 28,689
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 28,355
  10. Avatar for VeFold 10. VeFold 1 pt. 28,355

  1. Avatar for guineapig 21. guineapig Lv 1 18 pts. 28,871
  2. Avatar for grogar7 22. grogar7 Lv 1 16 pts. 28,861
  3. Avatar for akaaka 23. akaaka Lv 1 15 pts. 28,843
  4. Avatar for georg137 24. georg137 Lv 1 13 pts. 28,834
  5. Avatar for Steven Pletsch 25. Steven Pletsch Lv 1 12 pts. 28,817
  6. Avatar for WBarme1234 26. WBarme1234 Lv 1 11 pts. 28,808
  7. Avatar for alcor29 27. alcor29 Lv 1 9 pts. 28,776
  8. Avatar for silent gene 28. silent gene Lv 1 8 pts. 28,767
  9. Avatar for Joanna_H 29. Joanna_H Lv 1 8 pts. 28,689
  10. Avatar for fiendish_ghoul 30. fiendish_ghoul Lv 1 7 pts. 28,632

Comments