Placeholder image of a protein
Icon representing a puzzle

2318: Electron Density Reconstruction 45

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
June 14, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has two copies in it. The puzzle will likely look a bit familiar to those who have played other Reconstruction puzzles. Different structures, but similar look to them.

Sequence
PMISEEREPLADVIEKGDEIKVVAEVPGVNKEDIKVKVTNGGKKLVITAKSEDRQYYKEIDLPAEVDEKAAKANFKNGVLEITLKKKASS

Top groups


  1. Avatar for Go Science 100 pts. 29,115
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 29,084
  3. Avatar for Contenders 3. Contenders 37 pts. 29,004
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 29,003
  5. Avatar for Australia 5. Australia 11 pts. 28,880
  6. Avatar for Marvin's bunch 6. Marvin's bunch 5 pts. 28,874
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 28,808
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 28,689
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 28,355
  10. Avatar for VeFold 10. VeFold 1 pt. 28,355

  1. Avatar for Flagg65a 41. Flagg65a Lv 1 2 pts. 28,293
  2. Avatar for zbp 42. zbp Lv 1 1 pt. 28,233
  3. Avatar for ProfVince 43. ProfVince Lv 1 1 pt. 28,178
  4. Avatar for rosie4loop 44. rosie4loop Lv 1 1 pt. 28,101
  5. Avatar for abiogenesis 45. abiogenesis Lv 1 1 pt. 28,076
  6. Avatar for drp6 46. drp6 Lv 1 1 pt. 28,074
  7. Avatar for Merf 47. Merf Lv 1 1 pt. 27,857
  8. Avatar for jamiexq 48. jamiexq Lv 1 1 pt. 27,609
  9. Avatar for carxo 49. carxo Lv 1 1 pt. 27,543
  10. Avatar for Savas 50. Savas Lv 1 1 pt. 27,531

Comments