Placeholder image of a protein
Icon representing a puzzle

2318: Electron Density Reconstruction 45

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
June 14, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has two copies in it. The puzzle will likely look a bit familiar to those who have played other Reconstruction puzzles. Different structures, but similar look to them.

Sequence
PMISEEREPLADVIEKGDEIKVVAEVPGVNKEDIKVKVTNGGKKLVITAKSEDRQYYKEIDLPAEVDEKAAKANFKNGVLEITLKKKASS

Top groups


  1. Avatar for Go Science 100 pts. 29,115
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 29,084
  3. Avatar for Contenders 3. Contenders 37 pts. 29,004
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 29,003
  5. Avatar for Australia 5. Australia 11 pts. 28,880
  6. Avatar for Marvin's bunch 6. Marvin's bunch 5 pts. 28,874
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 28,808
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 28,689
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 28,355
  10. Avatar for VeFold 10. VeFold 1 pt. 28,355

  1. Avatar for Mohoernchen 51. Mohoernchen Lv 1 1 pt. 27,530
  2. Avatar for Larini 52. Larini Lv 1 1 pt. 27,527
  3. Avatar for Dr.Sillem 53. Dr.Sillem Lv 1 1 pt. 27,493
  4. Avatar for frostschutz 54. frostschutz Lv 1 1 pt. 27,433
  5. Avatar for pruneau_44 55. pruneau_44 Lv 1 1 pt. 27,424
  6. Avatar for DScott 56. DScott Lv 1 1 pt. 27,401
  7. Avatar for rinze 57. rinze Lv 1 1 pt. 27,385
  8. Avatar for Casey Cramp 58. Casey Cramp Lv 1 1 pt. 27,349
  9. Avatar for Swapper242 59. Swapper242 Lv 1 1 pt. 27,325
  10. Avatar for Valle2002 60. Valle2002 Lv 1 1 pt. 27,260

Comments