Placeholder image of a protein
Icon representing a puzzle

2318: Electron Density Reconstruction 45

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
June 14, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has two copies in it. The puzzle will likely look a bit familiar to those who have played other Reconstruction puzzles. Different structures, but similar look to them.

Sequence
PMISEEREPLADVIEKGDEIKVVAEVPGVNKEDIKVKVTNGGKKLVITAKSEDRQYYKEIDLPAEVDEKAAKANFKNGVLEITLKKKASS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 29,115
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 29,084
  3. Avatar for Contenders 3. Contenders 37 pts. 29,004
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 29,003
  5. Avatar for Australia 5. Australia 11 pts. 28,880
  6. Avatar for Marvin's bunch 6. Marvin's bunch 5 pts. 28,874
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 28,808
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 28,689
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 28,355
  10. Avatar for VeFold 10. VeFold 1 pt. 28,355
  1. Avatar for Punzi Baker 3 11. Punzi Baker 3 Lv 1 46 pts. 28,969
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 42 pts. 28,963
  3. Avatar for dcrwheeler 13. dcrwheeler Lv 1 38 pts. 28,961
  4. Avatar for BootsMcGraw 14. BootsMcGraw Lv 1 35 pts. 28,938
  5. Avatar for phi16 15. phi16 Lv 1 32 pts. 28,937
  6. Avatar for BackBuffer 16. BackBuffer Lv 1 29 pts. 28,926
  7. Avatar for NinjaGreg 17. NinjaGreg Lv 1 27 pts. 28,882
  8. Avatar for maithra 18. maithra Lv 1 24 pts. 28,880
  9. Avatar for AlkiP0Ps 19. AlkiP0Ps Lv 1 22 pts. 28,880
  10. Avatar for fpc 20. fpc Lv 1 20 pts. 28,874

Comments