Placeholder image of a protein
Icon representing a puzzle

2321: Electron Density Reconstruction 46

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
June 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has two copies in it.

Sequence
MDGVYVLSVKEDVPAAGILHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTPGIGILEHHHHHH

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 23,938
  2. Avatar for VeFold 12. VeFold 1 pt. 23,938
  3. Avatar for :) 13. :) 1 pt. 23,628
  4. Avatar for Andrew's Foldit group 14. Andrew's Foldit group 1 pt. 22,767
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 22,745
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 4,514
  1. Avatar for BootsMcGraw 21. BootsMcGraw Lv 1 25 pts. 24,823
  2. Avatar for guineapig 22. guineapig Lv 1 23 pts. 24,812
  3. Avatar for maithra 23. maithra Lv 1 21 pts. 24,693
  4. Avatar for phi16 24. phi16 Lv 1 19 pts. 24,670
  5. Avatar for AlkiP0Ps 25. AlkiP0Ps Lv 1 18 pts. 24,664
  6. Avatar for silent gene 26. silent gene Lv 1 16 pts. 24,646
  7. Avatar for alcor29 27. alcor29 Lv 1 15 pts. 24,618
  8. Avatar for ShadowTactics 28. ShadowTactics Lv 1 14 pts. 24,574
  9. Avatar for jausmh 29. jausmh Lv 1 12 pts. 24,516
  10. Avatar for spvincent 30. spvincent Lv 1 11 pts. 24,487

Comments