Placeholder image of a protein
Icon representing a puzzle

2321: Electron Density Reconstruction 46

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
June 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has two copies in it.

Sequence
MDGVYVLSVKEDVPAAGILHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTPGIGILEHHHHHH

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 23,938
  2. Avatar for VeFold 12. VeFold 1 pt. 23,938
  3. Avatar for :) 13. :) 1 pt. 23,628
  4. Avatar for Andrew's Foldit group 14. Andrew's Foldit group 1 pt. 22,767
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 22,745
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 4,514
  1. Avatar for alyssa_d_V2.0 71. alyssa_d_V2.0 Lv 1 1 pt. 22,745
  2. Avatar for Just_A_Nerd 72. Just_A_Nerd Lv 1 1 pt. 22,721
  3. Avatar for choram 73. choram Lv 1 1 pt. 22,416
  4. Avatar for deathbat_87 74. deathbat_87 Lv 1 1 pt. 21,746
  5. Avatar for bergie72 75. bergie72 Lv 1 1 pt. 21,495
  6. Avatar for Alistair69 76. Alistair69 Lv 1 1 pt. 21,185
  7. Avatar for fpc 77. fpc Lv 1 1 pt. 18,248
  8. Avatar for ivalnic 78. ivalnic Lv 1 1 pt. 17,284
  9. Avatar for Altercomp 79. Altercomp Lv 1 1 pt. 16,009
  10. Avatar for molleke 80. molleke Lv 1 1 pt. 4,514

Comments