Placeholder image of a protein
Icon representing a puzzle

2321: Electron Density Reconstruction 46

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
June 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has two copies in it.

Sequence
MDGVYVLSVKEDVPAAGILHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTPGIGILEHHHHHH

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 23,938
  2. Avatar for VeFold 12. VeFold 1 pt. 23,938
  3. Avatar for :) 13. :) 1 pt. 23,628
  4. Avatar for Andrew's Foldit group 14. Andrew's Foldit group 1 pt. 22,767
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 22,745
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 4,514
  1. Avatar for Hillbillie 81. Hillbillie Lv 1 1 pt. 4,419
  2. Avatar for jeff101 82. jeff101 Lv 1 1 pt. 4,419

Comments