Icon representing a puzzle

2320: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
July 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for :) 11. :) 1 pt. 8,974
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 8,957
  3. Avatar for Cannabis Crew 13. Cannabis Crew 1 pt. 8,911
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,626
  1. Avatar for hansvandenhof 31. hansvandenhof Lv 1 7 pts. 9,432
  2. Avatar for Flagg65a 32. Flagg65a Lv 1 6 pts. 9,389
  3. Avatar for Anfinsen_slept_here 33. Anfinsen_slept_here Lv 1 6 pts. 9,271
  4. Avatar for jamiexq 34. jamiexq Lv 1 5 pts. 9,236
  5. Avatar for georg137 35. georg137 Lv 1 4 pts. 9,232
  6. Avatar for Arne Heessels 36. Arne Heessels Lv 1 4 pts. 9,231
  7. Avatar for jakeanderson 37. jakeanderson Lv 1 3 pts. 9,175
  8. Avatar for ShadowTactics 38. ShadowTactics Lv 1 3 pts. 9,153
  9. Avatar for abiogenesis 39. abiogenesis Lv 1 3 pts. 9,150
  10. Avatar for carxo 40. carxo Lv 1 2 pts. 9,123

Comments