Icon representing a puzzle

2320: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
July 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,020
  2. Avatar for Contenders 2. Contenders 68 pts. 9,891
  3. Avatar for Go Science 3. Go Science 44 pts. 9,878
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 9,645
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 9,536
  6. Avatar for Australia 6. Australia 9 pts. 9,487
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 9,460
  8. Avatar for BOINC@Poland 8. BOINC@Poland 3 pts. 9,153
  9. Avatar for VeFold 9. VeFold 1 pt. 9,123
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 9,121

  1. Avatar for hansvandenhof 31. hansvandenhof Lv 1 7 pts. 9,432
  2. Avatar for Flagg65a 32. Flagg65a Lv 1 6 pts. 9,389
  3. Avatar for jamiexq 34. jamiexq Lv 1 5 pts. 9,236
  4. Avatar for georg137 35. georg137 Lv 1 4 pts. 9,232
  5. Avatar for Arne Heessels 36. Arne Heessels Lv 1 4 pts. 9,231
  6. Avatar for jakeanderson 37. jakeanderson Lv 1 3 pts. 9,175
  7. Avatar for ShadowTactics 38. ShadowTactics Lv 1 3 pts. 9,153
  8. Avatar for abiogenesis 39. abiogenesis Lv 1 3 pts. 9,150
  9. Avatar for carxo 40. carxo Lv 1 2 pts. 9,123

Comments