Placeholder image of a protein
Icon representing a puzzle

2326: Electron Density Reconstruction 48

Closed since almost 3 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
July 11, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has four chains in it, two of each type. Two have the sequence GIVEQCCTSICSLYQLENYCN and two have the sequence FVNQHLCGEHLVEALYLVCGERGFFYTPKT.

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 19,013
  2. Avatar for A generic group 12. A generic group 1 pt. 18,950
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 18,674

  1. Avatar for MicElephant 11. MicElephant Lv 1 48 pts. 19,664
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 44 pts. 19,656
  3. Avatar for Joanna_H 13. Joanna_H Lv 1 41 pts. 19,646
  4. Avatar for blazegeek 14. blazegeek Lv 1 37 pts. 19,637
  5. Avatar for alcor29 15. alcor29 Lv 1 34 pts. 19,631
  6. Avatar for guineapig 16. guineapig Lv 1 32 pts. 19,621
  7. Avatar for fpc 17. fpc Lv 1 29 pts. 19,617
  8. Avatar for gmn 18. gmn Lv 1 27 pts. 19,617
  9. Avatar for Wanderer09 19. Wanderer09 Lv 1 24 pts. 19,604
  10. Avatar for silent gene 20. silent gene Lv 1 22 pts. 19,603

Comments


LociOiling Lv 1

PDB 1B9E, titled "HUMAN INSULIN MUTANT SERB9GLU" is a match for the protein in this puzzle.

The SERB9GLU part means the serine normally found at residue 9 in chain B has mutated to glutamate in this version of insulin.

The Foldit classic revisiting puzzle 58: Insulin Mutant also features an "insulin mutant", but it has serine at B9. The revisiting puzzle only has chains A and B, where puzzle 2326 also has C and D chains. Chain A has the same sequence as chain C, and chain B matches chain D.