Placeholder image of a protein
Icon representing a puzzle

2326: Electron Density Reconstruction 48

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
July 11, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has four chains in it, two of each type. Two have the sequence GIVEQCCTSICSLYQLENYCN and two have the sequence FVNQHLCGEHLVEALYLVCGERGFFYTPKT.

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 19,013
  2. Avatar for A generic group 12. A generic group 1 pt. 18,950
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 18,674

  1. Avatar for BlueEqualsRed 71. BlueEqualsRed Lv 1 1 pt. 18,908
  2. Avatar for furi0us 72. furi0us Lv 1 1 pt. 18,907
  3. Avatar for AlphaFold2 73. AlphaFold2 Lv 1 1 pt. 18,674

Comments


LociOiling Lv 1

PDB 1B9E, titled "HUMAN INSULIN MUTANT SERB9GLU" is a match for the protein in this puzzle.

The SERB9GLU part means the serine normally found at residue 9 in chain B has mutated to glutamate in this version of insulin.

The Foldit classic revisiting puzzle 58: Insulin Mutant also features an "insulin mutant", but it has serine at B9. The revisiting puzzle only has chains A and B, where puzzle 2326 also has C and D chains. Chain A has the same sequence as chain C, and chain B matches chain D.