Placeholder image of a protein
Icon representing a puzzle

2326: Electron Density Reconstruction 48

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
July 11, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has four chains in it, two of each type. Two have the sequence GIVEQCCTSICSLYQLENYCN and two have the sequence FVNQHLCGEHLVEALYLVCGERGFFYTPKT.

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 19,720
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 19,718
  3. Avatar for Contenders 3. Contenders 41 pts. 19,678
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 19,667
  5. Avatar for Gargleblasters 5. Gargleblasters 14 pts. 19,646
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 19,617
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 19,586
  8. Avatar for Australia 8. Australia 2 pts. 19,582
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 19,456
  10. Avatar for VeFold 10. VeFold 1 pt. 19,098
  1. Avatar for akaaka 21. akaaka Lv 1 20 pts. 19,602
  2. Avatar for WBarme1234 22. WBarme1234 Lv 1 18 pts. 19,586
  3. Avatar for Steven Pletsch 23. Steven Pletsch Lv 1 17 pts. 19,585
  4. Avatar for AlkiP0Ps 24. AlkiP0Ps Lv 1 15 pts. 19,582
  5. Avatar for Anfinsen_slept_here 25. Anfinsen_slept_here Lv 1 14 pts. 19,573
  6. Avatar for phi16 26. phi16 Lv 1 12 pts. 19,548
  7. Avatar for georg137 27. georg137 Lv 1 11 pts. 19,520
  8. Avatar for RichGuilmain 28. RichGuilmain Lv 1 10 pts. 19,516
  9. Avatar for equilibria 29. equilibria Lv 1 9 pts. 19,508
  10. Avatar for manu8170 30. manu8170 Lv 1 8 pts. 19,497

Comments

LociOiling Lv 1

PDB 1B9E, titled "HUMAN INSULIN MUTANT SERB9GLU" is a match for the protein in this puzzle.

The SERB9GLU part means the serine normally found at residue 9 in chain B has mutated to glutamate in this version of insulin.

The Foldit classic revisiting puzzle 58: Insulin Mutant also features an "insulin mutant", but it has serine at B9. The revisiting puzzle only has chains A and B, where puzzle 2326 also has C and D chains. Chain A has the same sequence as chain C, and chain B matches chain D.