Placeholder image of a protein
Icon representing a puzzle

2326: Electron Density Reconstruction 48

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
July 11, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has four chains in it, two of each type. Two have the sequence GIVEQCCTSICSLYQLENYCN and two have the sequence FVNQHLCGEHLVEALYLVCGERGFFYTPKT.

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 19,720
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 19,718
  3. Avatar for Contenders 3. Contenders 41 pts. 19,678
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 19,667
  5. Avatar for Gargleblasters 5. Gargleblasters 14 pts. 19,646
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 19,617
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 19,586
  8. Avatar for Australia 8. Australia 2 pts. 19,582
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 19,456
  10. Avatar for VeFold 10. VeFold 1 pt. 19,098
  1. Avatar for dahast.de 61. dahast.de Lv 1 1 pt. 19,013
  2. Avatar for rinze 62. rinze Lv 1 1 pt. 19,003
  3. Avatar for froschi2 63. froschi2 Lv 1 1 pt. 18,978
  4. Avatar for crabapple 64. crabapple Lv 1 1 pt. 18,950
  5. Avatar for woohs0125 65. woohs0125 Lv 1 1 pt. 18,931
  6. Avatar for ivalnic 66. ivalnic Lv 1 1 pt. 18,929
  7. Avatar for AmphotericinB 67. AmphotericinB Lv 1 1 pt. 18,922
  8. Avatar for MrTyphlosion1000 68. MrTyphlosion1000 Lv 1 1 pt. 18,919
  9. Avatar for 146075 69. 146075 Lv 1 1 pt. 18,913
  10. Avatar for User098123 70. User098123 Lv 1 1 pt. 18,909

Comments

LociOiling Lv 1

PDB 1B9E, titled "HUMAN INSULIN MUTANT SERB9GLU" is a match for the protein in this puzzle.

The SERB9GLU part means the serine normally found at residue 9 in chain B has mutated to glutamate in this version of insulin.

The Foldit classic revisiting puzzle 58: Insulin Mutant also features an "insulin mutant", but it has serine at B9. The revisiting puzzle only has chains A and B, where puzzle 2326 also has C and D chains. Chain A has the same sequence as chain C, and chain B matches chain D.