Placeholder image of a protein
Icon representing a puzzle

2329: Electron Density Reconstruction 49

Closed since almost 3 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
July 12, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
APVRSLNCGLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 24,562
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 24,551
  3. Avatar for A generic group 13. A generic group 1 pt. 23,327

  1. Avatar for akaaka 21. akaaka Lv 1 16 pts. 26,424
  2. Avatar for WBarme1234 22. WBarme1234 Lv 1 15 pts. 26,408
  3. Avatar for Anfinsen_slept_here 23. Anfinsen_slept_here Lv 1 13 pts. 26,368
  4. Avatar for phi16 24. phi16 Lv 1 12 pts. 26,368
  5. Avatar for AlkiP0Ps 25. AlkiP0Ps Lv 1 10 pts. 26,342
  6. Avatar for guineapig 26. guineapig Lv 1 9 pts. 26,244
  7. Avatar for nicobul 27. nicobul Lv 1 8 pts. 26,170
  8. Avatar for argyrw 28. argyrw Lv 1 7 pts. 26,163
  9. Avatar for maithra 29. maithra Lv 1 6 pts. 26,134
  10. Avatar for Trajan464 30. Trajan464 Lv 1 6 pts. 26,107

Comments