Placeholder image of a protein
Icon representing a puzzle

2329: Electron Density Reconstruction 49

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
July 12, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
APVRSLNCGLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 26,974
  2. Avatar for Go Science 2. Go Science 65 pts. 26,918
  3. Avatar for Contenders 3. Contenders 41 pts. 26,792
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 26,791
  5. Avatar for Gargleblasters 5. Gargleblasters 14 pts. 26,657
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 26,565
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 26,408
  8. Avatar for Australia 8. Australia 2 pts. 26,342
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 26,042
  10. Avatar for VeFold 10. VeFold 1 pt. 25,002
  1. Avatar for akaaka 21. akaaka Lv 1 16 pts. 26,424
  2. Avatar for WBarme1234 22. WBarme1234 Lv 1 15 pts. 26,408
  3. Avatar for Anfinsen_slept_here 23. Anfinsen_slept_here Lv 1 13 pts. 26,368
  4. Avatar for phi16 24. phi16 Lv 1 12 pts. 26,368
  5. Avatar for AlkiP0Ps 25. AlkiP0Ps Lv 1 10 pts. 26,342
  6. Avatar for guineapig 26. guineapig Lv 1 9 pts. 26,244
  7. Avatar for nicobul 27. nicobul Lv 1 8 pts. 26,170
  8. Avatar for argyrw 28. argyrw Lv 1 7 pts. 26,163
  9. Avatar for maithra 29. maithra Lv 1 6 pts. 26,134
  10. Avatar for Trajan464 30. Trajan464 Lv 1 6 pts. 26,107

Comments