Placeholder image of a protein
Icon representing a puzzle

2335: Electron Density Reconstruction 51

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
July 27, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
QTVEAMAQGLPAPSYWKNERGSELLIWSANSGTIQGTFTNHAQGFACQGIPYPAAGSVSPTGLYFVVTFAQCNSFTRWVGTIKGSQMPTSWTLFYVDNKGKPSRLKGGDIFTRVW

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 23,040
  2. Avatar for Contenders 2. Contenders 56 pts. 23,014
  3. Avatar for Go Science 3. Go Science 29 pts. 23,014
  4. Avatar for Australia 4. Australia 14 pts. 22,887
  5. Avatar for Marvin's bunch 5. Marvin's bunch 6 pts. 22,878
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 2 pts. 22,750
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 1 pt. 22,683
  8. Avatar for AlphaFold 8. AlphaFold 1 pt. 22,550
  9. Avatar for VeFold 9. VeFold 1 pt. 22,550
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 22,442

  1. Avatar for georg137 31. georg137 Lv 1 4 pts. 22,577
  2. Avatar for AlphaFold2 32. AlphaFold2 Lv 1 3 pts. 22,550
  3. Avatar for Wiz kid 33. Wiz kid Lv 1 3 pts. 22,504
  4. Avatar for Trajan464 34. Trajan464 Lv 1 3 pts. 22,490
  5. Avatar for argyrw 35. argyrw Lv 1 2 pts. 22,475
  6. Avatar for maithra 36. maithra Lv 1 2 pts. 22,462
  7. Avatar for Joanna_H 37. Joanna_H Lv 1 2 pts. 22,442
  8. Avatar for hada 38. hada Lv 1 1 pt. 22,420
  9. Avatar for Gonegirl 39. Gonegirl Lv 1 1 pt. 22,405
  10. Avatar for Steven Pletsch 40. Steven Pletsch Lv 1 1 pt. 22,399

Comments