2335: Electron Density Reconstruction 51

Closed since over 2 years ago

Summary

• Created: July 27, 2023
• Expires: August 10, 2023 at 18:00 UTC
• Max points: 100

Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

• Sequence: QTVEAMAQGLPAPSYWKNERGSELLIWSANSGTIQGTFTNHAQGFACQGIPYPAAGSVSPTGLYFVVTFAQCNSFTRWVGTIKGSQMPTSWTLFYVDNKGKPSRLKGGDIFTRVW

Top groups

• 1. Anthropic Dreams 100 pts. 23,040
• 2. Contenders 56 pts. 23,014
• 3. Go Science 29 pts. 23,014
• 4. Australia 14 pts. 22,887
• 5. Marvin's bunch 6 pts. 22,878
• 6. L'Alliance Francophone 2 pts. 22,750
• 7. FamilyBarmettler 1 pt. 22,683
• 8. AlphaFold 1 pt. 22,550
• 9. VeFold 1 pt. 22,550
• 10. Gargleblasters 1 pt. 22,442

Top soloists

• 61. Arne Heessels 1 pt. 20,909
• 62. zsrail 1 pt. 16,578

Comments

[Artoria2e5]

NCBI smartblast (sorry, I can't wait for blastp) returns the most similar match as https://www.ncbi.nlm.nih.gov/protein/AJA65759.1, something with an avidin domain. avidins are known to bind biotin very tightly!

Okay, the full blastp says this is one of the bradavidin II structures from https://pubmed.ncbi.nlm.nih.gov/23661323/, already published on PDB. The paper is free on PMC.