Placeholder image of a protein
Icon representing a puzzle

2335: Electron Density Reconstruction 51

Closed since over 2 years ago

Novice Novice Novice Novice Overall Overall Overall Overall Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density

Summary


Created
July 27, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
QTVEAMAQGLPAPSYWKNERGSELLIWSANSGTIQGTFTNHAQGFACQGIPYPAAGSVSPTGLYFVVTFAQCNSFTRWVGTIKGSQMPTSWTLFYVDNKGKPSRLKGGDIFTRVW

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 23,040
  2. Avatar for Contenders 2. Contenders 56 pts. 23,014
  3. Avatar for Go Science 3. Go Science 29 pts. 23,014
  4. Avatar for Australia 4. Australia 14 pts. 22,887
  5. Avatar for Marvin's bunch 5. Marvin's bunch 6 pts. 22,878
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 2 pts. 22,750
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 1 pt. 22,683
  8. Avatar for AlphaFold 8. AlphaFold 1 pt. 22,550
  9. Avatar for VeFold 9. VeFold 1 pt. 22,550
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 22,442

  1. Avatar for Arne Heessels 61. Arne Heessels Lv 1 1 pt. 20,909
  2. Avatar for zsrail 62. zsrail Lv 1 1 pt. 16,578

Comments