Placeholder image of a protein
Icon representing a puzzle

2338: Electron Density Reconstruction 52 (Trim tool recommended)

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
August 03, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's 5 copies of the protein in this one, so it gets pretty large, and the Trim tool is recommended.

Sequence
GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPER

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 53,325
  2. Avatar for Go Science 2. Go Science 63 pts. 53,121
  3. Avatar for Contenders 3. Contenders 37 pts. 53,061
  4. Avatar for Marvin's bunch 4. Marvin's bunch 21 pts. 52,709
  5. Avatar for Australia 5. Australia 11 pts. 52,429
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 52,353
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 51,587
  8. Avatar for VeFold 8. VeFold 1 pt. 51,566
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 51,566
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 51,196
  1. Avatar for dcrwheeler 11. dcrwheeler Lv 1 43 pts. 52,713
  2. Avatar for fpc 12. fpc Lv 1 39 pts. 52,709
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 36 pts. 52,687
  4. Avatar for NinjaGreg 14. NinjaGreg Lv 1 33 pts. 52,662
  5. Avatar for Bletchley Park 15. Bletchley Park Lv 1 30 pts. 52,642
  6. Avatar for Steven Pletsch 16. Steven Pletsch Lv 1 27 pts. 52,571
  7. Avatar for g_b 17. g_b Lv 1 24 pts. 52,506
  8. Avatar for silent gene 18. silent gene Lv 1 22 pts. 52,476
  9. Avatar for ichwilldiesennamen 19. ichwilldiesennamen Lv 1 20 pts. 52,445
  10. Avatar for AlkiP0Ps 20. AlkiP0Ps Lv 1 18 pts. 52,429

Comments