Placeholder image of a protein
Icon representing a puzzle

2338: Electron Density Reconstruction 52 (Trim tool recommended)

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
August 03, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's 5 copies of the protein in this one, so it gets pretty large, and the Trim tool is recommended.

Sequence
GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPER

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 53,325
  2. Avatar for Go Science 2. Go Science 63 pts. 53,121
  3. Avatar for Contenders 3. Contenders 37 pts. 53,061
  4. Avatar for Marvin's bunch 4. Marvin's bunch 21 pts. 52,709
  5. Avatar for Australia 5. Australia 11 pts. 52,429
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 52,353
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 51,587
  8. Avatar for VeFold 8. VeFold 1 pt. 51,566
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 51,566
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 51,196
  1. Avatar for Merf 41. Merf Lv 1 1 pt. 50,312
  2. Avatar for akaaka 42. akaaka Lv 1 1 pt. 50,304
  3. Avatar for Artoria2e5 43. Artoria2e5 Lv 1 1 pt. 50,161
  4. Avatar for zbp 44. zbp Lv 1 1 pt. 49,716
  5. Avatar for georg137 45. georg137 Lv 1 1 pt. 49,590
  6. Avatar for Arne Heessels 46. Arne Heessels Lv 1 1 pt. 49,584
  7. Avatar for carxo 47. carxo Lv 1 1 pt. 49,379
  8. Avatar for Flagg65a 48. Flagg65a Lv 1 1 pt. 49,177
  9. Avatar for Deleted player 49. Deleted player 1 pt. 49,161
  10. Avatar for ucad 50. ucad Lv 1 1 pt. 48,875

Comments