Icon representing a puzzle

2337: Revisiting Puzzle 90: Heliomicin

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
August 11, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for NKSA 11. NKSA 1 pt. 7,520
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 0
  1. Avatar for rezaefar 61. rezaefar Lv 1 1 pt. 8,307
  2. Avatar for Gonegirl 62. Gonegirl Lv 1 1 pt. 8,266
  3. Avatar for Mohoernchen 63. Mohoernchen Lv 1 1 pt. 8,262
  4. Avatar for Deleted player 64. Deleted player 1 pt. 7,890
  5. Avatar for pruneau_44 65. pruneau_44 Lv 1 1 pt. 7,758
  6. Avatar for sftgfop1 66. sftgfop1 Lv 1 1 pt. 7,756
  7. Avatar for TokyoTF 67. TokyoTF Lv 1 1 pt. 7,733
  8. Avatar for furi0us 68. furi0us Lv 1 1 pt. 7,674
  9. Avatar for quackquack 69. quackquack Lv 1 1 pt. 7,637
  10. Avatar for Nussbmic-NKSA 70. Nussbmic-NKSA Lv 1 1 pt. 7,520

Comments