Icon representing a puzzle

2337: Revisiting Puzzle 90: Heliomicin

Closed since almost 3 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 11, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,834
  2. Avatar for Go Science 2. Go Science 63 pts. 9,760
  3. Avatar for Contenders 3. Contenders 37 pts. 9,720
  4. Avatar for VeFold 4. VeFold 21 pts. 9,659
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 11 pts. 9,591
  6. Avatar for Australia 6. Australia 5 pts. 9,516
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 2 pts. 9,509
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 9,451
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 9,252
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 9,049

  1. Avatar for rezaefar 61. rezaefar Lv 1 1 pt. 8,307
  2. Avatar for Gonegirl 62. Gonegirl Lv 1 1 pt. 8,266
  3. Avatar for Mohoernchen 63. Mohoernchen Lv 1 1 pt. 8,262
  4. Avatar for Deleted player 64. Deleted player 1 pt. 7,890
  5. Avatar for pruneau_44 65. pruneau_44 Lv 1 1 pt. 7,758
  6. Avatar for sftgfop1 66. sftgfop1 Lv 1 1 pt. 7,756
  7. Avatar for TokyoTF 67. TokyoTF Lv 1 1 pt. 7,733
  8. Avatar for furi0us 68. furi0us Lv 1 1 pt. 7,674
  9. Avatar for quackquack 69. quackquack Lv 1 1 pt. 7,637
  10. Avatar for Nussbmic-NKSA 70. Nussbmic-NKSA Lv 1 1 pt. 7,520

Comments