Icon representing a puzzle

2340: Revisiting Puzzle 91: Virus Protein

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
August 11, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,551
  2. Avatar for Go Science 2. Go Science 63 pts. 10,444
  3. Avatar for Contenders 3. Contenders 37 pts. 10,245
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 10,205
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 10,025
  6. Avatar for Australia 6. Australia 5 pts. 10,018
  7. Avatar for VeFold 7. VeFold 2 pts. 9,959
  8. Avatar for AlphaFold 8. AlphaFold 1 pt. 9,941
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,926
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,327

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,551
  2. Avatar for blazegeek 2. blazegeek Lv 1 94 pts. 10,515
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 88 pts. 10,444
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 82 pts. 10,414
  5. Avatar for Galaxie 5. Galaxie Lv 1 76 pts. 10,371
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 71 pts. 10,361
  7. Avatar for grogar7 7. grogar7 Lv 1 66 pts. 10,337
  8. Avatar for Sandrix72 8. Sandrix72 Lv 1 61 pts. 10,333
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 56 pts. 10,318
  10. Avatar for BackBuffer 10. BackBuffer Lv 1 52 pts. 10,274

Comments