Icon representing a puzzle

2340: Revisiting Puzzle 91: Virus Protein

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
August 11, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 8,652
  2. Avatar for Window Group 12. Window Group 1 pt. 3,869

  1. Avatar for Aubade01 11. Aubade01 Lv 1 48 pts. 10,252
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 45 pts. 10,245
  3. Avatar for MicElephant 13. MicElephant Lv 1 41 pts. 10,223
  4. Avatar for gmn 14. gmn Lv 1 38 pts. 10,222
  5. Avatar for christioanchauvin 15. christioanchauvin Lv 1 35 pts. 10,205
  6. Avatar for ichwilldiesennamen 16. ichwilldiesennamen Lv 1 32 pts. 10,189
  7. Avatar for guineapig 17. guineapig Lv 1 30 pts. 10,157
  8. Avatar for silent gene 18. silent gene Lv 1 27 pts. 10,114
  9. Avatar for Artoria2e5 19. Artoria2e5 Lv 1 25 pts. 10,106
  10. Avatar for Bletchley Park 20. Bletchley Park Lv 1 23 pts. 10,090

Comments