Icon representing a puzzle

2340: Revisiting Puzzle 91: Virus Protein

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
August 11, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 8,652
  2. Avatar for Window Group 12. Window Group 1 pt. 3,869
  1. Avatar for Flagg65a 21. Flagg65a Lv 1 21 pts. 10,085
  2. Avatar for alcor29 22. alcor29 Lv 1 19 pts. 10,067
  3. Avatar for akaaka 23. akaaka Lv 1 17 pts. 10,066
  4. Avatar for g_b 24. g_b Lv 1 16 pts. 10,040
  5. Avatar for fpc 25. fpc Lv 1 14 pts. 10,025
  6. Avatar for ucad 26. ucad Lv 1 13 pts. 10,024
  7. Avatar for AlkiP0Ps 27. AlkiP0Ps Lv 1 12 pts. 10,018
  8. Avatar for maithra 28. maithra Lv 1 10 pts. 9,991
  9. Avatar for Hillbillie 29. Hillbillie Lv 1 9 pts. 9,959
  10. Avatar for hansvandenhof 30. hansvandenhof Lv 1 8 pts. 9,947

Comments