Icon representing a puzzle

2340: Revisiting Puzzle 91: Virus Protein

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
August 11, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 8,652
  2. Avatar for Window Group 12. Window Group 1 pt. 3,869

  1. Avatar for AlphaFold2 31. AlphaFold2 Lv 1 8 pts. 9,941
  2. Avatar for nicobul 33. nicobul Lv 1 6 pts. 9,938
  3. Avatar for WBarme1234 34. WBarme1234 Lv 1 5 pts. 9,926
  4. Avatar for heather-1 35. heather-1 Lv 1 5 pts. 9,900
  5. Avatar for phi16 36. phi16 Lv 1 4 pts. 9,886
  6. Avatar for Wanderer09 37. Wanderer09 Lv 1 4 pts. 9,844
  7. Avatar for NPrincipi 38. NPrincipi Lv 1 3 pts. 9,792
  8. Avatar for roarshock 39. roarshock Lv 1 3 pts. 9,680
  9. Avatar for ProfVince 40. ProfVince Lv 1 3 pts. 9,561

Comments