Icon representing a puzzle

2340: Revisiting Puzzle 91: Virus Protein

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
August 11, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 8,652
  2. Avatar for Window Group 12. Window Group 1 pt. 3,869
  1. Avatar for Steven Pletsch 41. Steven Pletsch Lv 1 2 pts. 9,425
  2. Avatar for pfirth 42. pfirth Lv 1 2 pts. 9,342
  3. Avatar for ShadowTactics 43. ShadowTactics Lv 1 2 pts. 9,327
  4. Avatar for Dr.Sillem 44. Dr.Sillem Lv 1 2 pts. 9,325
  5. Avatar for rosie4loop 45. rosie4loop Lv 1 1 pt. 9,320
  6. Avatar for Arne Heessels 46. Arne Heessels Lv 1 1 pt. 9,207
  7. Avatar for Wiz kid 47. Wiz kid Lv 1 1 pt. 9,192
  8. Avatar for carxo 48. carxo Lv 1 1 pt. 9,117
  9. Avatar for badgoes 49. badgoes Lv 1 1 pt. 9,108
  10. Avatar for hada 50. hada Lv 1 1 pt. 9,089

Comments