Icon representing a puzzle

2340: Revisiting Puzzle 91: Virus Protein

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
August 11, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 8,652
  2. Avatar for Window Group 12. Window Group 1 pt. 3,869
  1. Avatar for Merf 51. Merf Lv 1 1 pt. 9,070
  2. Avatar for abiogenesis 52. abiogenesis Lv 1 1 pt. 8,971
  3. Avatar for DScott 53. DScott Lv 1 1 pt. 8,884
  4. Avatar for Trajan464 54. Trajan464 Lv 1 1 pt. 8,869
  5. Avatar for apetrides 55. apetrides Lv 1 1 pt. 8,865
  6. Avatar for zbp 56. zbp Lv 1 1 pt. 8,824
  7. Avatar for Gonegirl 57. Gonegirl Lv 1 1 pt. 8,761
  8. Avatar for Will the pill 58. Will the pill Lv 1 1 pt. 8,666
  9. Avatar for zo3xiaJonWeinberg 59. zo3xiaJonWeinberg Lv 1 1 pt. 8,652
  10. Avatar for Oransche 60. Oransche Lv 1 1 pt. 8,651

Comments