Icon representing a puzzle

2340: Revisiting Puzzle 91: Virus Protein

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
August 11, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 8,652
  2. Avatar for Window Group 12. Window Group 1 pt. 3,869

  1. Avatar for Altercomp 61. Altercomp Lv 1 1 pt. 8,629
  2. Avatar for rinze 62. rinze Lv 1 1 pt. 8,566
  3. Avatar for Deleted player 63. Deleted player 1 pt. 8,558
  4. Avatar for alematics 64. alematics Lv 1 1 pt. 8,511
  5. Avatar for HavocOrder0999 65. HavocOrder0999 Lv 1 1 pt. 8,488
  6. Avatar for Math13 66. Math13 Lv 1 1 pt. 8,311
  7. Avatar for B. A. Beder 67. B. A. Beder Lv 1 1 pt. 8,291
  8. Avatar for Mohoernchen 68. Mohoernchen Lv 1 1 pt. 8,244
  9. Avatar for J0hhny-B0i 69. J0hhny-B0i Lv 1 1 pt. 8,068
  10. Avatar for pruneau_44 70. pruneau_44 Lv 1 1 pt. 8,062

Comments