Icon representing a puzzle

2340: Revisiting Puzzle 91: Virus Protein

Closed since almost 3 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 11, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 8,652
  2. Avatar for Window Group 12. Window Group 1 pt. 3,869

  1. Avatar for furi0us 71. furi0us Lv 1 1 pt. 8,047
  2. Avatar for argonaut 72. argonaut Lv 1 1 pt. 7,401
  3. Avatar for jvjesse 73. jvjesse Lv 1 1 pt. 4,425
  4. Avatar for jflat06 74. jflat06 Lv 1 1 pt. 3,869

Comments