Icon representing a puzzle

2346: Revisiting Puzzle 93: Spider Toxin

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 7,760
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 7,580
  3. Avatar for Andrew's Foldit group 13. Andrew's Foldit group 1 pt. 7,381

  1. Avatar for BootsMcGraw 11. BootsMcGraw Lv 1 50 pts. 9,755
  2. Avatar for guineapig 12. guineapig Lv 1 46 pts. 9,753
  3. Avatar for Bruno Kestemont 13. Bruno Kestemont Lv 1 43 pts. 9,752
  4. Avatar for grogar7 14. grogar7 Lv 1 40 pts. 9,720
  5. Avatar for Galaxie 15. Galaxie Lv 1 37 pts. 9,687
  6. Avatar for ichwilldiesennamen 16. ichwilldiesennamen Lv 1 34 pts. 9,684
  7. Avatar for BackBuffer 17. BackBuffer Lv 1 31 pts. 9,684
  8. Avatar for Punzi Baker 3 18. Punzi Baker 3 Lv 1 29 pts. 9,674
  9. Avatar for silent gene 19. silent gene Lv 1 26 pts. 9,568
  10. Avatar for akaaka 20. akaaka Lv 1 24 pts. 9,566

Comments