Icon representing a puzzle

2346: Revisiting Puzzle 93: Spider Toxin

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 7,760
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 7,580
  3. Avatar for Andrew's Foldit group 13. Andrew's Foldit group 1 pt. 7,381
  1. Avatar for hansvandenhof 21. hansvandenhof Lv 1 22 pts. 9,552
  2. Avatar for Joanna_H 22. Joanna_H Lv 1 20 pts. 9,538
  3. Avatar for fpc 23. fpc Lv 1 19 pts. 9,527
  4. Avatar for Hillbillie 24. Hillbillie Lv 1 17 pts. 9,508
  5. Avatar for Artoria2e5 25. Artoria2e5 Lv 1 15 pts. 9,503
  6. Avatar for maithra 26. maithra Lv 1 14 pts. 9,474
  7. Avatar for heather-1 27. heather-1 Lv 1 13 pts. 9,437
  8. Avatar for WBarme1234 28. WBarme1234 Lv 1 12 pts. 9,431
  9. Avatar for alcor29 29. alcor29 Lv 1 11 pts. 9,422
  10. Avatar for SuperEnzyme 30. SuperEnzyme Lv 1 10 pts. 9,390

Comments