Icon representing a puzzle

2346: Revisiting Puzzle 93: Spider Toxin

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 7,760
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 7,580
  3. Avatar for Andrew's Foldit group 13. Andrew's Foldit group 1 pt. 7,381

  1. Avatar for rosie4loop 31. rosie4loop Lv 1 9 pts. 9,357
  2. Avatar for phi16 32. phi16 Lv 1 8 pts. 9,288
  3. Avatar for Idiotboy 33. Idiotboy Lv 1 7 pts. 9,090
  4. Avatar for Simek 34. Simek Lv 1 6 pts. 9,055
  5. Avatar for Gonegirl 35. Gonegirl Lv 1 6 pts. 8,963
  6. Avatar for ProfVince 36. ProfVince Lv 1 5 pts. 8,906
  7. Avatar for fiendish_ghoul 37. fiendish_ghoul Lv 1 5 pts. 8,902
  8. Avatar for MirsadaH 38. MirsadaH Lv 1 4 pts. 8,859
  9. Avatar for Wiz kid 39. Wiz kid Lv 1 4 pts. 8,752
  10. Avatar for Merf 40. Merf Lv 1 3 pts. 8,746

Comments