Icon representing a puzzle

2346: Revisiting Puzzle 93: Spider Toxin

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 7,760
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 7,580
  3. Avatar for Andrew's Foldit group 13. Andrew's Foldit group 1 pt. 7,381

  1. Avatar for RichGuilmain 51. RichGuilmain Lv 1 1 pt. 8,433
  2. Avatar for zbp 52. zbp Lv 1 1 pt. 8,383
  3. Avatar for jfryk 53. jfryk Lv 1 1 pt. 8,337
  4. Avatar for badgoes 54. badgoes Lv 1 1 pt. 8,206
  5. Avatar for Oransche 55. Oransche Lv 1 1 pt. 8,194
  6. Avatar for osc 56. osc Lv 1 1 pt. 8,089
  7. Avatar for yurib 57. yurib Lv 1 1 pt. 8,043
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 7,921
  9. Avatar for ivalnic 59. ivalnic Lv 1 1 pt. 7,793
  10. Avatar for ShadowTactics 60. ShadowTactics Lv 1 1 pt. 7,760

Comments