Icon representing a puzzle

2346: Revisiting Puzzle 93: Spider Toxin

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 7,760
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 7,580
  3. Avatar for Andrew's Foldit group 13. Andrew's Foldit group 1 pt. 7,381
  1. Avatar for furi0us 71. furi0us Lv 1 1 pt. 6,825
  2. Avatar for Trajan464 72. Trajan464 Lv 1 1 pt. 6,430
  3. Avatar for Devilsball 73. Devilsball Lv 1 1 pt. 5,520
  4. Avatar for citizenscientist 74. citizenscientist Lv 1 1 pt. 3,883
  5. Avatar for Simon 75. Simon Lv 1 1 pt. 668
  6. Avatar for SkeptiKarl 76. SkeptiKarl Lv 1 1 pt. 668
  7. Avatar for Sausagroll 77. Sausagroll Lv 1 1 pt. 668

Comments