Icon representing a puzzle

2349: Revisiting Puzzle 94: Mouse

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,804
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,761
  3. Avatar for Belgium 13. Belgium 1 pt. 8,456
  4. Avatar for Weber CHM3010 F2020 14. Weber CHM3010 F2020 1 pt. 8,203

  1. Avatar for gmn 11. gmn Lv 1 56 pts. 9,764
  2. Avatar for ichwilldiesennamen 12. ichwilldiesennamen Lv 1 52 pts. 9,731
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 49 pts. 9,719
  4. Avatar for christioanchauvin 14. christioanchauvin Lv 1 46 pts. 9,694
  5. Avatar for silent gene 15. silent gene Lv 1 43 pts. 9,683
  6. Avatar for jausmh 16. jausmh Lv 1 40 pts. 9,653
  7. Avatar for g_b 17. g_b Lv 1 38 pts. 9,616
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 35 pts. 9,613
  9. Avatar for akaaka 19. akaaka Lv 1 33 pts. 9,611
  10. Avatar for Punzi Baker 3 20. Punzi Baker 3 Lv 1 31 pts. 9,610

Comments


Will the pill Lv 1

There seems to be some mismatch between the description and the puzzle. The description has 70 segments and two disulfide bonds; the puzzle has 48 segments and five disulfide bonds. FYI.

LociOiling Lv 1

Here I was going to joke that there's always more than one mouse. There are two "mouse" revisiting puzzles, but this is not one of them. Instead, it appears to be a repost of revisiting puzzle 93. We just wrapped another revisit to that puzzle today (2346), so it's a little soon. Not sure if the Foldit team will post the correct puzzle or let it roll.