Icon representing a puzzle

2349: Revisiting Puzzle 94: Mouse

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,991
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 9,955
  3. Avatar for Contenders 3. Contenders 47 pts. 9,825
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 9,702
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 9,694
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 9,613
  7. Avatar for VeFold 7. VeFold 7 pts. 9,462
  8. Avatar for Australia 8. Australia 4 pts. 9,249
  9. Avatar for Void Crushers 9. Void Crushers 2 pts. 9,185
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,111
  1. Avatar for NinjaGreg
    1. NinjaGreg Lv 1
    100 pts. 9,991
  2. Avatar for LociOiling 2. LociOiling Lv 1 95 pts. 9,955
  3. Avatar for blazegeek 3. blazegeek Lv 1 90 pts. 9,877
  4. Avatar for Sandrix72 4. Sandrix72 Lv 1 85 pts. 9,868
  5. Avatar for Galaxie 5. Galaxie Lv 1 80 pts. 9,853
  6. Avatar for MicElephant 6. MicElephant Lv 1 75 pts. 9,825
  7. Avatar for Bletchley Park 7. Bletchley Park Lv 1 71 pts. 9,822
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 67 pts. 9,816
  9. Avatar for guineapig 9. guineapig Lv 1 63 pts. 9,805
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 59 pts. 9,787

Comments