Icon representing a puzzle

2349: Revisiting Puzzle 94: Mouse

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,804
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,761
  3. Avatar for Belgium 13. Belgium 1 pt. 8,456
  4. Avatar for Weber CHM3010 F2020 14. Weber CHM3010 F2020 1 pt. 8,203
  5. Avatar for Team Schleswig-Holstein 15. Team Schleswig-Holstein 1 pt. 7,396
  1. Avatar for Idiotboy 41. Idiotboy Lv 1 6 pts. 8,864
  2. Avatar for Merf 42. Merf Lv 1 5 pts. 8,849
  3. Avatar for ShadowTactics 43. ShadowTactics Lv 1 5 pts. 8,804
  4. Avatar for grogar7 44. grogar7 Lv 1 4 pts. 8,785
  5. Avatar for Oransche 45. Oransche Lv 1 4 pts. 8,763
  6. Avatar for AlphaFold2 46. AlphaFold2 Lv 1 3 pts. 8,761
  7. Avatar for Arne Heessels 47. Arne Heessels Lv 1 3 pts. 8,618
  8. Avatar for Larini 48. Larini Lv 1 3 pts. 8,599
  9. Avatar for mondetta77 49. mondetta77 Lv 1 3 pts. 8,580
  10. Avatar for carxo 50. carxo Lv 1 2 pts. 8,550

Comments

Will the pill Lv 1

There seems to be some mismatch between the description and the puzzle. The description has 70 segments and two disulfide bonds; the puzzle has 48 segments and five disulfide bonds. FYI.

LociOiling Lv 1

Here I was going to joke that there's always more than one mouse. There are two "mouse" revisiting puzzles, but this is not one of them. Instead, it appears to be a repost of revisiting puzzle 93. We just wrapped another revisit to that puzzle today (2346), so it's a little soon. Not sure if the Foldit team will post the correct puzzle or let it roll.