Icon representing a puzzle

2349: Revisiting Puzzle 94: Mouse

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,804
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,761
  3. Avatar for Belgium 13. Belgium 1 pt. 8,456
  4. Avatar for Weber CHM3010 F2020 14. Weber CHM3010 F2020 1 pt. 8,203

  1. Avatar for eweber 61. eweber Lv 1 1 pt. 8,203
  2. Avatar for abiogenesis 62. abiogenesis Lv 1 1 pt. 8,191
  3. Avatar for osc 63. osc Lv 1 1 pt. 8,082
  4. Avatar for ivalnic123 64. ivalnic123 Lv 1 1 pt. 8,037
  5. Avatar for yutakko 65. yutakko Lv 1 1 pt. 8,020
  6. Avatar for Docilya 66. Docilya Lv 1 1 pt. 7,664
  7. Avatar for Mineral 67. Mineral Lv 1 1 pt. 7,653
  8. Avatar for Steven Pletsch 68. Steven Pletsch Lv 1 1 pt. 7,591
  9. Avatar for Yechan Kwon 69. Yechan Kwon Lv 1 1 pt. 7,566
  10. Avatar for hada 70. hada Lv 1 1 pt. 7,528

Comments


Will the pill Lv 1

There seems to be some mismatch between the description and the puzzle. The description has 70 segments and two disulfide bonds; the puzzle has 48 segments and five disulfide bonds. FYI.

LociOiling Lv 1

Here I was going to joke that there's always more than one mouse. There are two "mouse" revisiting puzzles, but this is not one of them. Instead, it appears to be a repost of revisiting puzzle 93. We just wrapped another revisit to that puzzle today (2346), so it's a little soon. Not sure if the Foldit team will post the correct puzzle or let it roll.