Icon representing a puzzle

2349: Revisiting Puzzle 94: Mouse

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,804
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,761
  3. Avatar for Belgium 13. Belgium 1 pt. 8,456
  4. Avatar for Weber CHM3010 F2020 14. Weber CHM3010 F2020 1 pt. 8,203

  1. Avatar for Trajan464 71. Trajan464 Lv 1 1 pt. 7,493
  2. Avatar for Bithalbierer 72. Bithalbierer Lv 1 1 pt. 7,396
  3. Avatar for Mohoernchen 73. Mohoernchen Lv 1 1 pt. 7,241
  4. Avatar for mart0258 74. mart0258 Lv 1 1 pt. 7,187
  5. Avatar for Tonzi 75. Tonzi Lv 1 1 pt. 7,021
  6. Avatar for FernandoFG2395 76. FernandoFG2395 Lv 1 1 pt. 6,960
  7. Avatar for furi0us 77. furi0us Lv 1 1 pt. 6,909
  8. Avatar for alematics 78. alematics Lv 1 1 pt. 6,901
  9. Avatar for Harsh7596 79. Harsh7596 Lv 1 1 pt. 6,866
  10. Avatar for ioncube 80. ioncube Lv 1 1 pt. 6,859

Comments


Will the pill Lv 1

There seems to be some mismatch between the description and the puzzle. The description has 70 segments and two disulfide bonds; the puzzle has 48 segments and five disulfide bonds. FYI.

LociOiling Lv 1

Here I was going to joke that there's always more than one mouse. There are two "mouse" revisiting puzzles, but this is not one of them. Instead, it appears to be a repost of revisiting puzzle 93. We just wrapped another revisit to that puzzle today (2346), so it's a little soon. Not sure if the Foldit team will post the correct puzzle or let it roll.