Icon representing a puzzle

2349: Revisiting Puzzle 94: Mouse

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,991
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 9,955
  3. Avatar for Contenders 3. Contenders 47 pts. 9,825
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 9,702
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 9,694
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 9,613
  7. Avatar for VeFold 7. VeFold 7 pts. 9,462
  8. Avatar for Australia 8. Australia 4 pts. 9,249
  9. Avatar for Void Crushers 9. Void Crushers 2 pts. 9,185
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,111
  1. Avatar for TheFandomNerd 81. TheFandomNerd Lv 1 1 pt. 6,787
  2. Avatar for koolcoder101 82. koolcoder101 Lv 1 1 pt. 6,721
  3. Avatar for Andrey_ace 83. Andrey_ace Lv 1 1 pt. 6,613
  4. Avatar for manzet 84. manzet Lv 1 1 pt. 6,607
  5. Avatar for rhastings 85. rhastings Lv 1 1 pt. 6,428
  6. Avatar for cravens_riley 86. cravens_riley Lv 1 1 pt. 5,936
  7. Avatar for Ruslan 87. Ruslan Lv 1 1 pt. 4,489
  8. Avatar for amandaposkitt 88. amandaposkitt Lv 1 1 pt. 4,313
  9. Avatar for phi16 89. phi16 Lv 1 1 pt. 668
  10. Avatar for hilaolu 90. hilaolu Lv 1 1 pt. 668

Comments

Will the pill Lv 1

There seems to be some mismatch between the description and the puzzle. The description has 70 segments and two disulfide bonds; the puzzle has 48 segments and five disulfide bonds. FYI.

LociOiling Lv 1

Here I was going to joke that there's always more than one mouse. There are two "mouse" revisiting puzzles, but this is not one of them. Instead, it appears to be a repost of revisiting puzzle 93. We just wrapped another revisit to that puzzle today (2346), so it's a little soon. Not sure if the Foldit team will post the correct puzzle or let it roll.