Placeholder image of a protein
Icon representing a puzzle

2344: Electron Density Reconstruction 54 (Trim tool recommended)

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
August 21, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has a big protein chain and then two smaller protein chains as well. Also, it's pretty gigantic, so the Trim Tool is highly recommended.

Sequence
KKLIPILEKIPEVELPVKEITFKEKLKWTGIVLVLYFIMGCIDVYTAGAQIPAIFEFWGRIGTLITLGIGPIVTAGIIMQLLVGSGIIQMDLSIPENRALFQGCQKLLSIIMCFVEAVLFVGAGAFGILTPLLAFLVIIQIAFGSIILIYLDEIVSKYGIGSGIGLFIAAGVSQTIFVGALGPEGYLWKFLNSLIQGVPNIEYIAPIIGTIIVFLMVVYAECMRVEIPLAHGRIKGAVGKYPIKFVYVSNIPVILAAALFANIQLWGLALYRMGIPILGHYEGGRAVDGIAYYLSTPYGLSSVISDPIHAIVYMIAMIITCVMFGIFWVETTGLDPKSMAKRIGSLGMAIKGFRKSEKAIEHRLKRYIPPLTVMSSAFVGFLATIANFIGALGGGTGVLLTVSIVYRMYEQLLREKVSELHPAIAKL TDFNQKIEQLKEFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILK ETFSKIRVKPEHVIGVTVAFVIIEAILTYGRF

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 0

  1. Avatar for abiogenesis 51. abiogenesis Lv 1 1 pt. 43,106
  2. Avatar for carxo 52. carxo Lv 1 1 pt. 43,056
  3. Avatar for pruneau_44 53. pruneau_44 Lv 1 1 pt. 42,581
  4. Avatar for svman 54. svman Lv 1 1 pt. 42,560
  5. Avatar for sofiaeliasi 55. sofiaeliasi Lv 1 1 pt. 41,940
  6. Avatar for furi0us 56. furi0us Lv 1 1 pt. 41,163
  7. Avatar for ucad 57. ucad Lv 1 1 pt. 41,139
  8. Avatar for hada 58. hada Lv 1 1 pt. 39,863
  9. Avatar for Kineticcat_ 59. Kineticcat_ Lv 1 1 pt. 36,080
  10. Avatar for Arne Heessels 60. Arne Heessels Lv 1 1 pt. 27,115

Comments


Artoria2e5 Lv 1

This is the SecYEG translocon of Methanocaldococcus jannaschii. There are multiple PDB structures of this complex and I don't know which one this is.

AA Edit dumps

>A
kklipilekipevelpvkeitfkeklkwtgivlvlyfimgcidvytagaqipaifefwgrigtlitlgigpivtagiimqllvgsgiiqmdlsipenralfqgcqkllsiimcfveavlfvgagafgiltpllaflviiqiafgsiiliyldeivskygigsgiglfiaagvsqtifvgalgpegylwkflnsliqgvpnieyiapiigtiivflmvvyaecmrveiplahgrikgavgkypikfvyvsnipvilaaalfaniqlwglalyrmgipilghyeggravdgiayylstpyglssvisdpihaivymiamiitcvmfgifwvettgldpksmakrigslgmaikgfrksekaiehrlkryippltvmssafvgflatianfigalgggtgvlltvsivyrmyeqllrekvselhpaiakl
>B
tdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpatyikgilk
>C
etfskirvkpehvigvtvafviieailtygrf

Blasting A gives an exact match at 2YXQ, which has no unmodelled residues in-between. Good!

Oh, and don't worry too much about burials. A good chunk of this thing sits in a lipid membrane.