Placeholder image of a protein
Icon representing a puzzle

2347: Electron Density Reconstruction 55

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
August 25, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MARIRHEKEKLLADLDWEIGEIAQYTPLIVDFLVPDDILAMAADGLTPELKEKIQNEIIENHIALMALEEYSSLEHHHHHH

Top groups

  1. Avatar for Andrew's Foldit group 11. Andrew's Foldit group 1 pt. 16,259
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 16,257
  1. Avatar for dcrwheeler 11. dcrwheeler Lv 1 44 pts. 17,755
  2. Avatar for Punzi Baker 3 12. Punzi Baker 3 Lv 1 40 pts. 17,755
  3. Avatar for guineapig 13. guineapig Lv 1 37 pts. 17,751
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 33 pts. 17,748
  5. Avatar for fpc 15. fpc Lv 1 30 pts. 17,740
  6. Avatar for BackBuffer 16. BackBuffer Lv 1 27 pts. 17,739
  7. Avatar for BootsMcGraw 17. BootsMcGraw Lv 1 25 pts. 17,736
  8. Avatar for NPrincipi 18. NPrincipi Lv 1 22 pts. 17,735
  9. Avatar for akaaka 19. akaaka Lv 1 20 pts. 17,734
  10. Avatar for phi16 20. phi16 Lv 1 18 pts. 17,729

Comments

Artoria2e5 Lv 1

This looks like PDB 3T4R. You may find some unexpectedly chunky density around M39 (PDB# A 41) and M64 (PDB# A 66); that's because the original crystal uses selenomethionine, which replaces the S with Se. The bunch of H at the end is not part of the native sequence, but a His-tag.