Placeholder image of a protein
Icon representing a puzzle

2347: Electron Density Reconstruction 55

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
August 25, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MARIRHEKEKLLADLDWEIGEIAQYTPLIVDFLVPDDILAMAADGLTPELKEKIQNEIIENHIALMALEEYSSLEHHHHHH

Top groups

  1. Avatar for Andrew's Foldit group 11. Andrew's Foldit group 1 pt. 16,259
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 16,257
  1. Avatar for rosie4loop 31. rosie4loop Lv 1 5 pts. 17,675
  2. Avatar for MirsadaH 32. MirsadaH Lv 1 4 pts. 17,668
  3. Avatar for Oransche 33. Oransche Lv 1 4 pts. 17,666
  4. Avatar for Wiz kid 34. Wiz kid Lv 1 3 pts. 17,660
  5. Avatar for apetrides 35. apetrides Lv 1 3 pts. 17,637
  6. Avatar for zbp 36. zbp Lv 1 3 pts. 17,609
  7. Avatar for ProfVince 37. ProfVince Lv 1 2 pts. 17,603
  8. Avatar for maithra 38. maithra Lv 1 2 pts. 17,532
  9. Avatar for AlphaFold2 39. AlphaFold2 Lv 1 2 pts. 17,523
  10. Avatar for Larini 40. Larini Lv 1 2 pts. 17,490

Comments

Artoria2e5 Lv 1

This looks like PDB 3T4R. You may find some unexpectedly chunky density around M39 (PDB# A 41) and M64 (PDB# A 66); that's because the original crystal uses selenomethionine, which replaces the S with Se. The bunch of H at the end is not part of the native sequence, but a His-tag.