Placeholder image of a protein
Icon representing a puzzle

2347: Electron Density Reconstruction 55

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
August 25, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MARIRHEKEKLLADLDWEIGEIAQYTPLIVDFLVPDDILAMAADGLTPELKEKIQNEIIENHIALMALEEYSSLEHHHHHH

Top groups

  1. Avatar for Andrew's Foldit group 11. Andrew's Foldit group 1 pt. 16,259
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 16,257
  1. Avatar for Matia 51. Matia Lv 1 1 pt. 16,674
  2. Avatar for ucad 52. ucad Lv 1 1 pt. 16,665
  3. Avatar for ivalnic123 53. ivalnic123 Lv 1 1 pt. 16,648
  4. Avatar for Deleted player 54. Deleted player 1 pt. 16,635
  5. Avatar for anasaf 55. anasaf Lv 1 1 pt. 16,485
  6. Avatar for Dr.Sillem 56. Dr.Sillem Lv 1 1 pt. 16,476
  7. Avatar for rinze 57. rinze Lv 1 1 pt. 16,360
  8. Avatar for Mohoernchen 58. Mohoernchen Lv 1 1 pt. 16,331
  9. Avatar for osc 59. osc Lv 1 1 pt. 16,320
  10. Avatar for Just_A_Nerd 60. Just_A_Nerd Lv 1 1 pt. 16,302

Comments

Artoria2e5 Lv 1

This looks like PDB 3T4R. You may find some unexpectedly chunky density around M39 (PDB# A 41) and M64 (PDB# A 66); that's because the original crystal uses selenomethionine, which replaces the S with Se. The bunch of H at the end is not part of the native sequence, but a His-tag.