Placeholder image of a protein
Icon representing a puzzle

2347: Electron Density Reconstruction 55

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
August 25, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MARIRHEKEKLLADLDWEIGEIAQYTPLIVDFLVPDDILAMAADGLTPELKEKIQNEIIENHIALMALEEYSSLEHHHHHH

Top groups

  1. Avatar for Andrew's Foldit group 11. Andrew's Foldit group 1 pt. 16,259
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 16,257
  1. Avatar for andrewgood 61. andrewgood Lv 1 1 pt. 16,259
  2. Avatar for alyssa_d_V2.0 62. alyssa_d_V2.0 Lv 1 1 pt. 16,257
  3. Avatar for mart0258 63. mart0258 Lv 1 1 pt. 16,226
  4. Avatar for furi0us 64. furi0us Lv 1 1 pt. 16,122
  5. Avatar for 01010011111 65. 01010011111 Lv 1 1 pt. 15,448
  6. Avatar for Sausagroll 66. Sausagroll Lv 1 1 pt. 15,448
  7. Avatar for Fboar 67. Fboar Lv 1 1 pt. 12,254

Comments

Artoria2e5 Lv 1

This looks like PDB 3T4R. You may find some unexpectedly chunky density around M39 (PDB# A 41) and M64 (PDB# A 66); that's because the original crystal uses selenomethionine, which replaces the S with Se. The bunch of H at the end is not part of the native sequence, but a His-tag.