Placeholder image of a protein
Icon representing a puzzle

2347: Electron Density Reconstruction 55

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
August 25, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MARIRHEKEKLLADLDWEIGEIAQYTPLIVDFLVPDDILAMAADGLTPELKEKIQNEIIENHIALMALEEYSSLEHHHHHH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 17,783
  2. Avatar for Go Science 2. Go Science 63 pts. 17,774
  3. Avatar for Contenders 3. Contenders 37 pts. 17,764
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 17,760
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 17,740
  6. Avatar for Australia 6. Australia 5 pts. 17,725
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 17,705
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 17,668
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 17,523
  10. Avatar for VeFold 10. VeFold 1 pt. 17,523
  1. Avatar for AlkiP0Ps 21. AlkiP0Ps Lv 1 16 pts. 17,725
  2. Avatar for ichwilldiesennamen 22. ichwilldiesennamen Lv 1 15 pts. 17,717
  3. Avatar for hansvandenhof 23. hansvandenhof Lv 1 13 pts. 17,712
  4. Avatar for alcor29 24. alcor29 Lv 1 12 pts. 17,712
  5. Avatar for silent gene 25. silent gene Lv 1 10 pts. 17,706
  6. Avatar for Artoria2e5 26. Artoria2e5 Lv 1 9 pts. 17,705
  7. Avatar for WBarme1234 27. WBarme1234 Lv 1 8 pts. 17,705
  8. Avatar for Steven Pletsch 28. Steven Pletsch Lv 1 7 pts. 17,701
  9. Avatar for fiendish_ghoul 29. fiendish_ghoul Lv 1 6 pts. 17,683
  10. Avatar for Idiotboy 30. Idiotboy Lv 1 6 pts. 17,679

Comments

Artoria2e5 Lv 1

This looks like PDB 3T4R. You may find some unexpectedly chunky density around M39 (PDB# A 41) and M64 (PDB# A 66); that's because the original crystal uses selenomethionine, which replaces the S with Se. The bunch of H at the end is not part of the native sequence, but a His-tag.