Placeholder image of a protein
Icon representing a puzzle

2347: Electron Density Reconstruction 55

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
August 25, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MARIRHEKEKLLADLDWEIGEIAQYTPLIVDFLVPDDILAMAADGLTPELKEKIQNEIIENHIALMALEEYSSLEHHHHHH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 17,783
  2. Avatar for Go Science 2. Go Science 63 pts. 17,774
  3. Avatar for Contenders 3. Contenders 37 pts. 17,764
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 17,760
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 17,740
  6. Avatar for Australia 6. Australia 5 pts. 17,725
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 17,705
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 17,668
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 17,523
  10. Avatar for VeFold 10. VeFold 1 pt. 17,523

  1. Avatar for equilibria 41. equilibria Lv 1 1 pt. 17,485
  2. Avatar for Trajan464 42. Trajan464 Lv 1 1 pt. 17,454
  3. Avatar for Merf 43. Merf Lv 1 1 pt. 17,406
  4. Avatar for abiogenesis 44. abiogenesis Lv 1 1 pt. 17,392
  5. Avatar for Gonegirl 45. Gonegirl Lv 1 1 pt. 17,368
  6. Avatar for carxo 46. carxo Lv 1 1 pt. 17,307
  7. Avatar for DScott 47. DScott Lv 1 1 pt. 17,247
  8. Avatar for Docilya 48. Docilya Lv 1 1 pt. 17,046
  9. Avatar for RichGuilmain 49. RichGuilmain Lv 1 1 pt. 16,932
  10. Avatar for svman 50. svman Lv 1 1 pt. 16,825

Comments


Artoria2e5 Lv 1

This looks like PDB 3T4R. You may find some unexpectedly chunky density around M39 (PDB# A 41) and M64 (PDB# A 66); that's because the original crystal uses selenomethionine, which replaces the S with Se. The bunch of H at the end is not part of the native sequence, but a His-tag.